PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.B03684.1.p
Common NameEUGRSUZ_B03684
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 435aa    MW: 48131.7 Da    PI: 6.2367
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.B03684.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding452.4e-14127174148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +g W++eEd++l ++    G g+W+ +ar  g+ R++k+c++rw +yl
  Eucgr.B03684.1.p 127 KGLWSPEEDDKLMNYMLNNGQGCWSDVARNAGLQRCGKSCRLRWINYL 174
                       678*******************************************97 PP

2Myb_DNA-binding51.42.4e-16180223146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg+++++E+el+++++  lG++ W+ Ia++++ gRt++++k++w++
  Eucgr.B03684.1.p 180 RGAFSPQEEELIIHLHSILGNR-WSQIAARLP-GRTDNEIKNFWNS 223
                       89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.8E-23119177IPR009057Homeodomain-like
PROSITE profilePS5129415.709122174IPR017930Myb domain
SuperFamilySSF466891.6E-27125221IPR009057Homeodomain-like
SMARTSM007171.3E-9126176IPR001005SANT/Myb domain
PfamPF002494.5E-13127174IPR001005SANT/Myb domain
CDDcd001673.75E-8130174No hitNo description
PROSITE profilePS5129425.699175229IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.2E-26178230IPR009057Homeodomain-like
SMARTSM007175.3E-16179227IPR001005SANT/Myb domain
PfamPF002495.9E-15180223IPR001005SANT/Myb domain
CDDcd001671.71E-11182222No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0050832Biological Processdefense response to fungus
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 435 aa     Download sequence    Send to blast
MESKTRRPPP SLSLSLSLSL SQRSLSKPFS STNSLSLSLS LPYVSSKTHH HHHHHDDHEP  60
LQPFSTFLFI SSLYKKTFNL DPGWGRERVN ELPPPLCFIF DPASLKMRKP DASGKNSSNS  120
NANKLRKGLW SPEEDDKLMN YMLNNGQGCW SDVARNAGLQ RCGKSCRLRW INYLRPDLKR  180
GAFSPQEEEL IIHLHSILGN RWSQIAARLP GRTDNEIKNF WNSTIKKRLK NSSSSSCRHS  240
PNTSDSSLSS DVKDVMGGLI SLQEQGLMPL YMDSLSSVQA LALNQVIDPL LPSLNQGLDL  300
PGLSGYCDAN SNYCAVQGGV SGEFGRFGGV VGCGSNGDQL YVPPLESISI ENVKTENTYD  360
SEHNSSNDLS NFNYTTDDVV DNIGNFNDYG RIESMAGLGN LWNGGEEMKV GEWDLEELMK  420
DVSSFSSADF QVIQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-271252295108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00599PBMTransfer from AT5G12870Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.B03684.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010045019.10.0PREDICTED: transcription factor MYB46-like
SwissprotQ9LXV25e-75MYB46_ARATH; Transcription factor MYB46
TrEMBLA0A059D9890.0A0A059D989_EUCGR; Uncharacterized protein
STRINGPOPTR_0009s05860.11e-118(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61152347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.14e-70myb domain protein 46